General Information

  • ID:  hor004644
  • Uniprot ID:  Q8S8N0
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 4
  • Gene name:  CLE4
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE4p]: Expressed in roots and seedlings.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010075 regulation of meristem growth; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RPLVAEESPSDSGNIRKIMRELLKRSEELKVRSKDGQTVLGTLDSKRLSPGGPDPRHH
  • Length:  58
  • Propeptide:  MASFKLWVCLILLLLEFSVHQCRPLVAEESPSDSGNIRKIMRELLKRSEELKVRSKDGQTVLGTLDSKRLSPGGPDPRHH
  • Signal peptide:  MASFKLWVCLILLLLEFSVHQC
  • Modification:  T50 Hydroxyproline;T53 Hydroxyproline
  • Glycosylation:  T53 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8S8N0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004644_AF2.pdbhor004644_ESM.pdb

Physical Information

Mass: 749220 Formula: C275H468N90O88S
Absent amino acids: CFWY Common amino acids: LRS
pI: 10.6 Basic residues: 14
Polar residues: 15 Hydrophobic residues: 13
Hydrophobicity: -105.17 Boman Index: -18630
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 77.24
Instability Index: 8287.93 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA